.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o5z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Folylpolyglutamate synthase (TM0166) from Thermotoga maritima at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 1o5z Target Id 282046
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1188,TM0166 Molecular Weight 48865.97 Da.
    Residues 430 Isoelectric Point 6.55
    Sequence maylevlrylyhkrpmgkvkpglerismllsklgnphleyktihiggtngkgsvanmvsnilvsqgyrv gsyysphlstfrerirlneeyiseedvvkiyetmepilneldkeeifspsffevvtamaflyfaeknvd iavlevglggrldatnvvfplcstivtvdrdhektlgytieqiaweksgiikervplvtgerkrealkv medvarkkssrmyvidkdfsvkvkslklhenrfdycgentfedlvltmngphqienagvalktleatgl plsekaireglknaknlgrfeilekngkmyildgahnphgaeslvrslklyfngeplslvigilddknr edilrkytgifervivtrvpsprmkdmnslvdmakkffknveviedpleaiesteratvvtgslflvgy vreflttgkineewkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.24421
    Matthews' coefficent 2.80 Rfactor 0.18107
    Waters 323 Solvent Content 55.67

    Pathway

    Reactions found in Metabolic Reconstruction for TM0166

    Name: folylpolyglutamate synthetase TM
    Metabolic Subsystem: Folate Metabolism
    Reaction: : atp + glu-L + thf <==> adp + h + pi + thfglu
    Classification: EC:6.3.2.17
     
    Name: dihydrofolate synthase
    Metabolic Subsystem: Folate Metabolism
    Reaction: : atp + dhpt + glu-L --> adp + dhf + h + pi
    Classification: EC:6.3.2.12
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM0166 gene from Thermotoga maritima encodes a folylpolyglutamate synthase (FPGS) (PF02825, COG0285), an ATP-dependent enzyme that catalyzes the addition of a polyglutamate tail to folate and folate derivatives thereby playing a key role in the retention of intracellular folate. FPGS has been employed in the production of anticancer drugs with increased cytotoxicity [Ref] and is also considered an attractive target for anti-microbial therapy [Ref]. change.[Ref]

    The structure reveals a two-domain organization and is highly similar (main-chain rmsd 1.7 Å over 358 residues with a sequence identity of 33%) with the FPGS from Lactobacillus casei (PDB id: 2fgs [Ref]). The active site of TM0116, located in a large interdomain cleft adjacent to an ATP-binding P-loop motif (GTNGKGS, TM0116 residues 46-51), contains an unidentified ligand that by comparison with 2fgs and 1w7k is likely to be a mimetic for ATP. A second unidentified ligand, located along a C-terminal cleft, is likely to indicate the site of folate binding. See [Ref] for more details on the structure and active site.

    Ligand Summary

     

    References

    Reviews

    References

     

    1. Synold TW, Willits EM, and Barredo JC Role of folylpolygutamate synthetase (FPGS) in antifolate chemotherapy; a biochemical and clinical update. Leuk Lymphoma. 1996 Mar; 21(1-2):9-15 PubMed HubMed doi:10.3109/10428199609067573 pmid:8907263.

       


      Discuss this publication
    2. Mathieu M, Debousker G, Vincent S, Viviani F, Bamas-Jacques N, and Mikol V Escherichia coli FolC structure reveals an unexpected dihydrofolate binding site providing an attractive target for anti-microbial therapy. J Biol Chem. 2005 May 13; 280(19):18916-22 PubMed HubMed doi:10.1074/jbc.M413799200 pmid:15705579.

       


      Discuss this publication
    3. Netesova IG and Bobkova MR [Intralaboratory quality control in non-quantitative enzyme immunoassays of serological markers for various infections]. Klin Lab Diagn. 2011 Feb:35-7 PubMed HubMed pmid:21509987.

       


      Discuss this publication
    4. Sun X, Bognar AL, Baker EN, and Smith CA Structural homologies with ATP- and folate-binding enzymes in the crystal structure of folylpolyglutamate synthetase. Proc Natl Acad Sci U S A. 1998 Jun 9; 95(12):6647-52 PubMed HubMed pmid:9618466.

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch