.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o5o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of Uracil phosphoribosyltransferase (TM0721) from Thermotoga maritima at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 1o5o Target Id 282591
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1227,TM0721 Molecular Weight 23318.98 Da.
    Residues 209 Isoelectric Point 5.62
    Sequence mknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhlkceevevetpitktigyrind kdivvvpilraglvmadgilellpnasvghigiyrdpetlqaveyyaklpplnddkevflldpmlatgv ssikaieilkengakkitlvaliaapegveavekkyedvkiyvaalderlndhgyiipglgdagdrlfrtk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.23635
    Matthews' coefficent 2.44 Rfactor 0.16658
    Waters 355 Solvent Content 49.20

    Pathway

    Reactions found in Metabolic Reconstruction for TM0721

    Name: uracil phosphoribosyltransferase
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : prpp + ura --> ppi + ump
    Classification: EC:2.4.2.9
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM0721 gene from Thermotoga maritima encodes an uracil phosphoribosyltransferase (PF00156, COG0035, EC 2.4.2.9). The TM0721 structure adopts a phosphoribosyl-transferase-like fold and shows strong structural similarity with the homolog from another hyperthormophile, Thermus thermophilus (PDB id: 1v9s) with a main-chain rmsd of 1.0 Å over 206 residues and a sequence identity of 57%. Similar results were obtained with homologs from Escherichia coli (PDB id: 2ehj), Aquifex aeolicus (PDB id: 2e55), Burkholderia pseudomallei (PDB id: 3dmp) and Bacillus caldolyticus (PDB id: 1i5e). For more details on the structure and function of this enzyme see Kadziola 2002.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch