The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title On the use of DXMS to produce more crystallizable proteins: structures of the T. maritima proteins TM0160 and TM1171. Protein Sci. 13 3187-3199 2004
    Site JCSG
    PDB Id 1o5l Target Id 283036
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1268,TM1171, BV2565C,, 89405 Molecular Weight 23393.30 Da.
    Residues 201 Isoelectric Point 7.79
    Sequence mdlkkllpcgkvivfrkgeivkhqddpiedvlillegtlktehvsengktleideikpvqiiasgfifs seprfpvnvvagenskilsipkevfldllmkdrelllfflkdvsehfrvvseklfflttktlreklmnf lvrhmnekreltlpvtleelsrlfgcarpalsrvfqeleregyiekhgrrikvlknpfehdri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.25324
    Matthews' coefficent 3.01 Rfactor 0.19483
    Waters 111 Solvent Content 58.77

    Ligand Information


    Google Scholar output for 1o5l
    1. On the use of DXMS to produce more crystallizable proteins: structures of the T. maritima proteins TM0160 and TM1171
    G Spraggon, D Pantazatos, HE Klock, IA Wilson - Protein , 2004 - Wiley Online Library
    2. Microbial biochemistry, physiology, and biotechnology of hyperthermophilic Thermotoga species
    SB Conners, EF Mongodin, MR Johnson - FEMS microbiology , 2006 - Wiley Online Library
    3. Sequence or structure: using bioinformatics and homology modeling to understand functional relationships in cAMP/cGMP binding domains
    NA LaFranzo, MK Strulson, DM Yanker, LT Dang - Mol. BioSyst., 2010 - xlink.rsc.org
    4. Carbohydrate utilization pathway analysis in the hyperthermophile Thermotoga maritima
    SB Conners - 2006 - repository.lib.ncsu.edu

    Protein Summary

    The TM1171 gene from T. maritima encodes the NP_228976 protein, a transcriptional regulator (CrP family)  that belongs to PF00027 (cyclic nucleotide binding domain) and to COG0664 (cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases).

    1o5l has significant structural similarity to other transcriptional regulators from Crp/Fnr  family (PDB structure 2gau ; DALI Z-score 15.0; RMSD 2.9; 25% sequence identity within 122 superimposed residues) and also to other PDB structures (1pf0, 2beo, 1o7f, 1zyb, 2h6b) with double-stranded beta-helix SCOP fold [51181].

    Analysis of the crystallographic packing of 1o5l using the PQS server {Henrick, 1998 #73} indicates that a dimer is the biologically relevant form.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch