.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o5l

  • You do not have permissions to view this page - please try logging in.
Table of contents
  1. 1. Protein Summary
  2. 2. Ligand Summary
  3. 3. References
Title On the use of DXMS to produce more crystallizable proteins: structures of the T. maritima proteins TM0160 and TM1171. Protein Sci. 13 3187-3199 2004
Site JCSG
PDB Id 1o5l Target Id 283036
Molecular Characteristics
Source Thermotoga maritima msb8
Alias Ids TPS1268,TM1171 Molecular Weight 23393.30 Da.
Residues 201 Isoelectric Point 7.79
Sequence mdlkkllpcgkvivfrkgeivkhqddpiedvlillegtlktehvsengktleideikpvqiiasgfifs seprfpvnvvagenskilsipkevfldllmkdrelllfflkdvsehfrvvseklfflttktlreklmnf lvrhmnekreltlpvtleelsrlfgcarpalsrvfqeleregyiekhgrrikvlknpfehdri
  BLAST   FFAS

Structure Determination
Method XRAY Chains 1
Resolution (Å) 2.30 Rfree 0.25324
Matthews' coefficent 3.01 Rfactor 0.19483
Waters 111 Solvent Content 58.77

Ligand Information
Ligands
Metals

Jmol

 

Protein Summary

The TM1171 gene from T. maritima encodes the NP_228976 protein, a transcriptional regulator (CrP family)  that belongs to PF00027 (cyclic nucleotide binding domain) and to COG0664 (cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases).

1o5l has significant structural similarity to other transcriptional regulators from Crp/Fnr  family (PDB structure 2gau ; DALI Z-score 15.0; RMSD 2.9; 25% sequence identity within 122 superimposed residues) and also to other PDB structures (1pf0, 2beo, 1o7f, 1zyb, 2h6b) with double-stranded beta-helix SCOP fold [51181].

Analysis of the crystallographic packing of 1o5l using the PQS server {Henrick, 1998 #73} indicates that a dimer is the biologically relevant form.

Ligand Summary



References

Reviews

References

 

No references found.

Tag page

Files (0)

 
You must login to post a comment.
All content on this site is licensed under a Creative Commons Attribution 3.0 License
Powered by MindTouch