.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o5k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of Dihydrodipicolinate synthase (TM1521) from Thermotoga maritima at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 1o5k Target Id 283378
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1296,TM1521 Molecular Weight 32388.59 Da.
    Residues 294 Isoelectric Point 5.91
    Sequence mfrgvgtaivtpfkngeldlesyerlvryqlengvnalivlgttgesptvnedereklvsrtleivdgk ipvivgagtnstektlklvkqaeklgangvlvvtpyynkptqeglyqhykyisertdlgivvynvpgrt gvnvlpetaariaadlknvvgikeanpdidqidrtvsltkqarsdfmvwsgnddrtfyllcaggdgvis vvsnvapkqmvelcaeyfsgnleksrevhrklrplmkalfvetnpipvkaalnlmgfienelrlplvpa sektvellrnvlkesgll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.18593
    Matthews' coefficent 2.12 Rfactor 0.13941
    Waters 508 Solvent Content 41.42

    Pathway

    Reactions found in Metabolic Reconstruction for TM1521

    Name: dihydrodipicolinate synthase
    Metabolic Subsystem: Lysine Biosynthesis
    Reaction: : aspsa + pyr --> 23dhdp + h + h2o
    Classification: EC:4.2.1.52
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene TM1521 from Thermotoga maritima encodes dihydrodipicolinate synthase, a DHDPS enzyme superfamily PF00701 COG0329.  DHDPS is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways.  The other name of the enzyme is N-acetylneuraminate lyase.  DHDPS is a key enzyme in lysine biosynthesis. It catalyzes the aldol condensation of L-aspartate-beta-semialdehyde and pyruvate to dihydropicolinic acid via a Schiff base formation between pyruvate and a conserved lysine residue [Ref]. The functional enzyme is a homotetramer consisting of a dimer of dimers. The activity of DHDPS is allosterically regulated by the feedback inhibitor (S)-lysine.  The structure of E.coli homologue and its multiple mutant forms have been previously solved 1S5W, 2A6N.

    Ligand Summary



    References

    Reviews

    References

     

    1. Mirwaldt C, Kornd枚rfer I, and Huber R The crystal structure of dihydrodipicolinate synthase from Escherichia coli at 2.5 A resolution. J Mol Biol. 1995 Feb 10; 246(1):227-39 PubMed HubMed doi:10.1006/jmbi.1994.0078 pmid:7853400.

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch