.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o5i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of 3-oxoacyl-(acyl carrier protein) reductase (TM1169) from Thermotoga maritima at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 1o5i Target Id 283034
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1267,TM1169 Molecular Weight 26191.02 Da.
    Residues 237 Isoelectric Point 6.05
    Sequence melgirdkgvlvlaasrgigravadvlsqegaevticarneellkrsghryvvcdlrkdldllfekvke vdilvlnaggpkagffdeltnedfkeaidslflnmikivrnylpamkekgwgrivaitsfsvispienl ytsnsarmaltgflktlsfevapygitvncvapgwtetervkellseekkkqvesqipmrrmakpeeia svvaflcsekasyltgqtivvdgglskfpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.2468
    Matthews' coefficent 2.54 Rfactor 0.19404
    Waters 161 Solvent Content 51.23

    Pathway

    Reactions found in Metabolic Reconstruction for TM1169

    Name: 3-hydroxy-palmetoyl-ACP synthesis
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> 3hpalmACP + ACP + co2 + nadp

     
    Name: Fatty acid biosynthesis (n-C14:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : ddcaACP + h + malACP + nadph --> ACP + co2 + h2o + myrsACP + nadp

     
    Name: Fatty acid biosynthesis (n-C24:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : behenACP + h + malACP + nadph --> ACP + co2 + h2o + lgnACP + nadp

     
    Name: Fatty acid biosynthesis (n-C20:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + ocdcaACP --> ACP + arachACP + co2 + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C16:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> ACP + co2 + h2o + hdeACP + nadp

     
    Name: Fatty acid biosynthesis (n-C22:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : arachACP + h + malACP + nadph --> ACP + behenACP + co2 + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C18:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> ACP + co2 + h2o + nadp + octeACP

     
    Name: 3-hydroxy-octadecanoyl-ACP synthesis
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> 3hoctaACP + ACP + co2 + nadp

     
    Name: Fatty acid biosynthesis (n-C20:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + ocdcaACP --> ACP + aracheACP + co2 + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C10:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : actACP + h + malACP + nadph --> ACP + co2 + dcaACP + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C18:2)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + palmACP --> ACP + co2 + h2o + ocdcyaACP

     
    Name: Fatty acid biosynthesis (n-C12:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : dcaACP + h + malACP + nadph --> ACP + co2 + ddcaACP + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C14:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : ddcaACP + h + malACP + nadph --> ACP + co2 + h2o + nadp + tdeACP

     
    Name: Fatty acid biosynthesis (n-C16:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> ACP + co2 + h2o + nadp + palmACP

     
    Name: Fatty acid biosynthesis (n-C18:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> ACP + co2 + h2o + nadp + ocdcaACP

     
    Name: Fatty acid biosynthesis (n-C22:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : arachACP + h + malACP + nadph --> ACP + beheneACP + co2 + h2o + nadp

     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene TM1169 from Thermotoga maritima encodes 3-oxoacyl-(acyl carrier protein) fabG reductase EC:1.1.1.212.  The enzyme belongs to a superfamily of Rossmann-fold NAD(P)(+)-binding proteins COG4982.  This enzyme belongs to the family of oxidoreductases, specifically those acting on the CH-OH group of donor with NAD+ or NADP+ as acceptor. This enzyme participates in fatty acid biosynthesis and polyunsaturated fatty acid biosynthesis.  Dozens of  structures have been solved for this class of enzymes, e.g 3FDA from Rickettsia Prowazekii.  The amino acid sequence of this protein is highly identical (99%) to a short-chain dehydrogenase/reductase SDR PF00106 from Thermotoga petrophila.  It is possible that this enzyme has a rather broad substrate specificity.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch