.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o5h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of a formiminotetrahydrofolate cyclodeaminase (TM1560) from Thermotoga maritima at 2.80 A resolution reveals a new fold. Proteins 58 976-981 2005
    Site JCSG
    PDB Id 1o5h Target Id 283417
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1299,TM1560 Molecular Weight 22712.09 Da.
    Residues 202 Isoelectric Point 4.96
    Sequence meverlslkefcdmvaerkptpgggavgsvvgamacalaemvanftrkkkgyedvepemeriveameea rlklfdlakkdmeafekvmkaykssegelqnalkeaasvpmdvirvmkdlaheleklaefgnknlasdt lnaadlchavfqvekvnvlinlkeisdetfrknmleeleeqeaqiegcyqrvkkmlegivwssk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.27814
    Matthews' coefficent 2.84 Rfactor 0.19927
    Waters Solvent Content 56.40

    Pathway

    Reactions found in Metabolic Reconstruction for TM1560

    Name: formimidoyltransferase cyclodeaminase reversible
    Metabolic Subsystem: Folate Metabolism
    Reaction: : 5forthf + h <==> methf + nh4
    Classification: EC:4.3.1.4
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Formiminotetrahydrofolate cyclodeaminase (TM1560) from Thermotoga maritima (FTCD_CD, EC 4.3.1.4; COG3404, pfam04961) is involved in folate metabolism (PubMed:15651027).

    TM1560 is similar to protein domain of bifunctional, Golgi-associated formiminotransferase cyclodeaminase (PDB id: 1tt9) - a mammalian protein that plays important roles in coupling histidine catabolism with folate metabolism and integrating the Golgi complex with the vimentin intermediate filament cytoskeleton (PubMed:15272307).

    TM1560 has methenyltetrahydrofolate cyclohydrolase-like fold (SCOP sunid:101261) - closed 5 helical bundle with left-handed twist.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch