| Title | Crystal structure of an allantoicase (YIR029W) from Saccharomyces cerevisiae at 2.4 A resolution. Proteins 56 619-624 2004 | | Site | JCSG | | PDB Id | | Target Id | 355059 | | Molecular Characteristics | | Source | Saccharomyces cerevisiae | | Alias Ids | TPS1346,YIR029W | Molecular Weight | 38711.81 Da. | | Residues | 343 | Isoelectric Point | 5.93 | | Sequence | mkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenliqptapirdptrfvhsgawyd gwetrrhnemeydwviikmgvaaahiiggeidtaffngnhapfvsiealydegeegniveddsrwveiv ekfecgpsqrhlfvrgngltkerfthiklkmypdggiarfrlygrvvppelktkdhiidlayvcngava lkysdqhfgsvdnlllpgrghdmsdgwetkrsrqpghtdwaviqlgressfiekiivdtahfrgnfpqf itvegclkesessentgegtwvelvgksktgpdkehvyeirksirvshvkltiipdggvkrirvwgy | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.40 | Rfree | 0.22238 | | Matthews' coefficent | 2.87 | Rfactor | 0.17542 | | Waters | 218 | Solvent Content | 56.81 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The YIR029W from S. cerevisiae encodes allantoicase (EC 3.5.3.4;
COG4266), that converts allantoate to urea and ureidoglycolate in the second step of allantoin degradation.
Ligand Summary
References
