.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o58

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of O-acetylserine sulfhydrylase (TM0665) from Thermotoga maritima at 1.8 A resolution. Proteins 56 387-391 2004
    Site JCSG
    PDB Id 1o58 Target Id 282537
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1224,TM0665 Molecular Weight 31128.65 Da.
    Residues 291 Isoelectric Point 8.92
    Sequence mmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaekrgllkngiveptsgnmgiaia migakrghrviltmpetmsverrkvlkmlgaelvltpgelgmkgavekaleisretgahmlnqfenpyn vyshqfttgpeilkqmdyqidafvagvgtggtisgvgrvlkgffgngvkivavepakspvlsggqpgkh aiqgigagfvpkildrsvidevitvedeeayemarylakkegllvgissganvaaalkvaqklgpdarv vtvapdhaerylsil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.19807
    Matthews' coefficent 2.32 Rfactor 0.15738
    Waters 937 Solvent Content 46.50

    Pathway

    Reactions found in Metabolic Reconstruction for TM0665

    Name: cysteine synthase
    Other genes that carryout this rxn:TM0882
    Metabolic Subsystem: Cysteine Metabolism
    Reaction: : acser + h2s --> ac + cys-L + h

     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM0665 gene of Thermotoga maritima encodes a pyridoxal 5'-phosphate dependent O-acetylserine sulfhydrylase, that catalyzes the beta-replacement of the acetyl group in O-acetyl-L-serine by sulfide to generate L-cysteine with production of acetate (EC 4.2.99.8; CysK; COG0031,  PubMed:15211522). This enzyme can also generate S-sulfo-L-cysteine using thiosulfate instead of sulfide.  Metazoa and fungi does not have proteins homologous to TM0665, where cysteine is derived from methionine, but not from serine as in bacteria, archaea, and plants.

    Protein encoded by TM065 has tryptophan synthase beta subunit-like PLP-dependent enzymes fold (SCOP sunid: 53685) with two similar domains related by pseudo dyad. Each domain has 3 layers (a/b/a) core with parallel beta-sheet of 4 strands (order 3214). Please note, PDB structure 1j6n of TM0665 was replaced by PDB structure 1o58.


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1j6n.jpg
    No description
    25.29 kB20:09, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch