| Title | Crystal structure of SAM-dependent O-methyltransferase (TM0748) from Thermotoga maritima at 1.65 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 282618 | | Molecular Characteristics | | Source | Thermotoga maritima msb8 | | Alias Ids | TPS1230,TM0748 | Molecular Weight | 30105.25 Da. | | Residues | 265 | Isoelectric Point | 5.66 | | Sequence | mgkvadtlkpgdrvllsfedeseflvdlekdkklhthlgiidlnevfekgpgeiirtsagkkgyilips lideimnmkrrtqivypkdssfiammldvkegdriidtgvgsgamcavlaravgssgkvfayekreefa klaesnltkwgliervtikvrdisegfdekdvdalfldvpdpwnyidkcwealkgggrfatvcpttnqv qetlkklqelpfirievweslfrpykpvperlrpvdrmvahtaymifatkvcrreete | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.65 | Rfree | 0.18762 | | Matthews' coefficent | 2.57 | Rfactor | 0.15768 | | Waters | 295 | Solvent Content | 51.70 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The gene TM0748 from Thermotoga maritima encodes the GCD14-like subunit of the RNA methyltransferase complex PF08704 COG2519 E.C.2.1.1.62. Homologs are found in all domains of life. In eukaryotes, this complex is localized in the nucleus. GCD14 subunit is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [Ref]. GCD14 is essential protein required for the initiation of protein synthesis and translational repression of GCN4 mRNA.
Ligand Summary
References
