.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

Page Authors

 

T. maritima Browser

TOPSAN > Proteins > JCSG > 1o4w

1o4w

    Page last modified 23:03, 25 Oct 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of a PIN (PilT N-terminus) domain (AF0591) from Archaeoglobus fulgidus at 1.90 A resolution. Proteins 56 404-408 2004
    Site JCSG
    PDB Id 1o4w Target Id 354418
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS1330,2650039 Molecular Weight 15466.17 Da.
    Residues 135 Isoelectric Point 8.50
    Sequence meadrgrnnkvrcavvdtnvlmyvylnkadvvgqlrefgfsrflitasvkreleklemslrgkekvaar falkllehfevvetesegdpslieaaekygcilitndkelkrkakqrgipvgylkedkrvfvelld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.23508
    Matthews' coefficent 3.04 Rfactor 0.18843
    Waters 90 Solvent Content 59.23

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The AF0591 gene from Archaeoglobus fulgidus encodes the NP_069425 protein from the PilT N-term./Vapc superfamily (COG1412). It belongs to the PIN group (PF01850).

    Genomic neighbourhood and phylogenetic cooccurrence (STRING) indicates that AF0591 functions are related to protein translation. PilT-N terminal domain probably cleaves ribosome-associated transcripts (http://genomebiology.com/2003/4/12/R81).

      1o4w has a PIN domain-like fold (SCOP sunid: 88722) with 3 layers (?/?/?) core: parallel ?-sheet of 5 strands, order 32145, and is similar to: 2fe1A, 1w8iA, 1v8oA, 1y82A, 1v96A.

    Ligand Summary



    References

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch