.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o4t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of a putative oxalate decarboxylase (TM1287) from Thermotoga maritima at 1.95 A resolution. Proteins 56 392-395 2004
    Site JCSG
    PDB Id 1o4t Target Id 283151
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1275,TM1287 Molecular Weight 13269.49 Da.
    Residues 121 Isoelectric Point 5.64
    Sequence mkegtgmvvrsseitperisnmrggkgevemahllskeamhnkarlfarmklppgssvglhkhegefei yyillgegvfhdngkdvpikagdvcftdsgeshsientgntdleflaviill
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.217
    Matthews' coefficent 2.55 Rfactor 0.16
    Waters 198 Solvent Content 51.40

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene TM1287 from Thermotoga maritima translates into the NP_229091 protein from the cupin-2 domain family (PF07883).

    TM1287 has a double-stranded beta-helix fold (SCOP sunid:51181), where one turn of helix is made by two pairs of antiparallel strands linked with short turns has the appearance of a  beta-sandwich of distinct architecture and jelly-roll topology. TM1287 belongs to RmlC-like cupins superfamily (SCOP sunid:51182), TM1287-like family. Similar structures according to DALI are: TM1459 protein PDB:1vj2 (chain A, Z=16), PDB:1v70 (chain A, Z=15), TM1010 PDB:2f4p (Z=14), TTHA0104 PDB:2dct (Z=14), PDB:2h0v (chain A, Z=12), PDB:1lr5 (chain A, Z=13), PDB:1yhf (chain A, Z=12), PDB:1rc6 (chain A), PDB:2f4p (chain A), PDB:1sef (chain A), PDB:2b8m (chain A), PDB:1x7n (chain A), PDB:1sfn (chain A), PDB:1j3p (chain A), PDB:1gqg (chain A), PDB:1sq4 (chain A), PDB:1fi2 (chain A), PDB:2fqp (chain A), and PDB:1j58 (chain A). 

    1o4t structure was crystallized in the presence of oxalate and manganese. This hypothetical oxalate decarboxylase reveals a bidentate oxalate coordination to the active site manganese ion that in turn chelates residues H61, H63, E68 and H102 (PubMed:15211523). Oxalate decarboxylases regulate oxalate levels in plants and microbes by a Mn2+/O2-dependent carbon-carbon bond cleavage that results in the conversion of oxalate to CO2 and formate.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch