.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o3u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of an HEPN domain protein (TM0613) from Thermotoga maritima at 1.75 A resolution. PROTEINS 54 806-809 2004
    Site JCSG
    PDB Id 1o3u Target Id 282486
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1221,TM0613 Molecular Weight 14094.09 Da.
    Residues 123 Isoelectric Point 5.17
    Sequence mdaakddlehakhdlehgfynwacfssqqaaekavkavfqrmgaqawgysvpdflgelssrfeipeelm dhaleldkaciptrypdalpsgsprnrysrieaerlvnyaekiirfcedllsri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.237
    Matthews' coefficent 1.74 Rfactor 0.179
    Waters 128 Solvent Content 28.84

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene TM0613 from Thermotoga maritima encodes the NP_228423 protein that contains a putative nucleotide-binding domain (HEPN) (COG2250; smart00748; Pfam05168) present in several bacterial drug resistance and human proteins involved in neurodegenerative processes (PubMed: 12765831, 14997578).

    It is unknown if TM0613 phylogenetic cooccurrence (detected using string.embl.de server) with TM0841 (S-layer-like array protein;  reviewed in PubMed: 10648507) and TM1652 is significant enough to implicate functional interdependence between those proteins.

    TM0613 structure, 1o3u, has a up-and-down four-helical bundle fold (SCOP sunid: 47161) and belongs to the SCOP family of HEPN domains (probable bi-partite nucleotidyltransferase subunit; SCOP sunid 89022). TM0613 predicted partner is a putative catalytic subunit encoded by TM0614. DALI top hits are with the TT1696 protein PDB:1ufb (Z=18), the AF0298 protein PDB:2hsb (Z=15) and the CO2003 protein PDB:2q00 (Z=11).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch