.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o2d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of an iron-containing 1,3-propanediol dehydrogenase (TM0920) from Thermotoga maritima at 1.3 A resolution. Proteins 54 174-177 2004
    Site JCSG
    PDB Id 1o2d Target Id 375013
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1639,TM0920 Molecular Weight 39908.83 Da.
    Residues 359 Isoelectric Point 5.80
    Sequence vwefymptdvffgekilekrgniidllgkralvvtgkssskkngslddlkklldeteisyeifdeveen psfdnvmkaveryrndsfdfvvglgggspmdfakavavllkekdlsvedlydrekvkhwlpvveiptta gtgsevtpysiltdpegnkrgctlmfpvyafldprytysmsdeltlstgvdalshavegylsrkstpps dalaieamkiihrnlpkaiegnrearkkmfvasclagmviaqtgttlahalgyplttekgikhgkatgm vlpfvmevmkeeipekvdtvnhifggsllkflkelglyekvavsseelekwvekgsrakhlkntpgtft pekirniyrealgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.30 Rfree 0.17
    Matthews' coefficent 1.92 Rfactor 0.137
    Waters 892 Solvent Content 35.36

    Pathway

    Reactions found in Metabolic Reconstruction for TM0920

    Name: alcohol dehydrogenase (glycerol)
    Genes involved in rxn:TM0920 TM0111
    Metabolic Subsystem: Alternate Carbon Metabolism
    Reaction: : glyald + h + nadh <==> glyc + nad
    Classification: EC:1.1.1.1
     
    Name: acetaldehyde dehydrogenase (acetylating)
    Genes involved in rxn:TM0920 TM0111
    Metabolic Subsystem: Pyruvate Met
    Reaction: : acald + coa + nad --> accoa + h + nadh
    Classification: EC:1.2.1.10
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene  TM0920 from Thermotoga maritima encodes an iron-containing 1,3-propanediol dehydrogenase, a member of alcohol dehydrogenases family PF00465. The enzyme belongs to the class of multi-domain alpha and beta (a+b) proteins and adopts  dehydroquinate synthase-like fold type with well-defined Rossmann-like domain  SCOP56795.  1,3- propanediol dehydrogenase catalyzes the oxidation of propane-1,3-diol to 3-hydroxypropanal with the simultaneous reduction of NADP to NADPH.  Another four alcohol dehydrogenase paralogues of TM0920 have been identified in the Thermotoga proteome (TM0111, TM0285, TM0423, and TM0820) [Ref].  Alcohol dehydrogenases are a group of oxidoreductases that catalyze the interconversion of alcohols and the corresponding aldehyde or ketone.  Many of enzymes from this family are used  in the pharmaceutical industry to catalyze the synthesis of chiral compounds [Ref].

    Ligand Summary


    References

    Reviews

    References

     

    1. Schwarzenbacher R, von Delft F, Canaves JM, Brinen LS, Dai X, Deacon AM, Elsliger MA, Eshaghi S, Floyd R, Godzik A, Grittini C, Grzechnik SK, Guda C, Jaroszewski L, Karlak C, Klock HE, Koesema E, Kovarik JS, Kreusch A, Kuhn P, Lesley SA, McMullan D, McPhillips TM, Miller MA, Miller MD, Morse A, Moy K, Ouyang J, Page R, Robb A, Rodrigues K, Selby TL, Spraggon G, Stevens RC, van den Bedem H, Velasquez J, Vincent J, Wang X, West B, Wolf G, Hodgson KO, Wooley J, and Wilson IA Crystal structure of an iron-containing 1,3-propanediol dehydrogenase (TM0920) from Thermotoga maritima at 1.3 A resolution. Proteins. 2004 Jan 1; 54(1):174-7 PubMed HubMed doi:10.1002/prot.10594 pmid:14705036.

       


      Discuss this publication
    2. Hummel W Large-scale applications of NAD(P)-dependent oxidoreductases: recent developments. Trends Biotechnol. 1999 Dec; 17(12):487-92 PubMed HubMed pmid:10557162.

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch