.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

Page Authors

 

T. maritima Browser

TOPSAN > Proteins > JCSG > 1o22

1o22

    Page last modified 22:32, 25 Oct 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of an orphan protein (TM0875) from Thermotoga maritima at 2.00-A resolution reveals a new fold. Proteins 56 607-610 2004
    Site JCSG
    PDB Id 1o22 Target Id 282744
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1242,TM0875 Molecular Weight 18578.46 Da.
    Residues 158 Isoelectric Point 4.78
    Sequence mrlmdileilyykkgkefgilekkmkeifnetgvslepvnseligriflkisvleegeevpsfaikalt pkenavdlplgdwtdlknvfveeidyldsygdmkilseknwykiyvpyssvkkknrnelveefmkyffe skgwnpgeytfsvqeidnlf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.238
    Matthews' coefficent 2.32 Rfactor 0.182
    Waters 102 Solvent Content 46.59

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM0875 gene of Thermotoga maritima encodes a hypothetical protein NP_228683 (PubMed:15229892) of unknown function. Analysis of TM0875 genomic context reveals the presence of MMT1 (a predicted Co/Zn/Cd cation transporter) and an inactive homolog of metal-dependent proteases. Originally classified as an ORFan protein, its homologs were found in other Thermotoga species, and it was added to PFAM as a new family PF12967 (DUF3855).

    1o22 belongs to the alpha+beta class and has a new fold (SCOP sunid:90063): beta(2)-loop-beta(2)-alpha-beta of mixed beta-sheet with order 51243 (parallel strands: 2 and 4). The dimer is most likely the biologically relevant form.

    1o22 shows weak structural similarity with the phosphoribosylformylglycinamidine synthase 1t4a (Dali Z-scr=4.6), the yggU protein (PDB structure: 1n91; with DALI Z-scr=3;  PubMed:15229892), and with the thioesterase superfamily member (PDB structure 2cy9 - found using FATCAT), even though they have very low sequence identity.

    Ligand Summary



    References

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch