.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o20

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of gamma-glutamyl phosphate reductase (TM0293) from Thermotoga maritima at 2.0 A resolution. Proteins 54 157-161 2004
    Site JCSG
    PDB Id 1o20 Target Id 282169
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1197,TM0293, 89367 Molecular Weight 46401.77 Da.
    Residues 415 Isoelectric Point 5.98
    Sequence mdellekakkvreawdvlrnattreknkaikkiaeklderrkeileanridvekarergvkeslvdrla lndkridemikacetviglkdpvgevidswvredglriarvrvpigpigiiyesrpnvtvettilalks gntillrggsdalnsnkaivsairealketeipessvefientdrslvlemirlreylslviprggygl isfvrdnatvpvletgvgnchifvdesadlkkavpviinaktqrpgtcnaaekllvhekiakeflpviv eelrkhgvevrgcektreivpdvvpateddwpteyldliiaikvvknvdeaiehikkystghsesilte nysnakkfvseidaaavyvnastrftdggqfgfgaeigistqrfhargpvglrelttykfvvlgeyhvre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.203
    Matthews' coefficent 2.57 Rfactor 0.16
    Waters 299 Solvent Content 51.67

    Pathway

    Reactions found in Metabolic Reconstruction for TM0293

    Name: glutamate-5-semialdehyde dehydrogenase
    Metabolic Subsystem: Proline Biosynthesis
    Reaction: : glu5p + h + nadph --> glu5sa + nadp + pi
    Classification: EC:1.2.1.41
     

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1o20
    1. Structural biology of proline catabolism
    JJ Tanner - Amino acids, 2008 - Springer
     
    2. A Novel Two-domain Architecture Within the Amino Acid Kinase Enzyme Family Revealed by the Crystal Structure of Escherichia coli Glutamate 5-kinase
    C Marco-Marn, F Gil-Ortiz, I Prez-Arellano - Journal of molecular , 2007 - Elsevier
     
    3. Structural insights into the human and avian IMP cyclohydrolase mechanism via crystal structures with the bound XMP inhibitor
    DW Wolan, CG Cheong, SE Greasley, IA Wilson - Biochemistry, 2004 - ACS Publications
     
    4. Structure of avian AICAR transformylase with a multisubstrate adduct inhibitor _-DADF identifies the folate binding site
    DW Wolan, SE Greasley, J Mark, SJ Benkovic - Biochemistry, 2003 - ACS Publications
     
    5. Pyrroline_5_carboxylate synthase and proline biosynthesis: From osmotolerance to rare metabolic disease
    I Prez_Arellano, F Carmona_lvarez - Protein , 2010 - Wiley Online Library
     
    6. Crystal structure of __glutamyl phosphate reductase (TM0293) from Thermotoga maritima at 2.0 resolution
    R Page, MS Nelson, F von Delft - Proteins: Structure, , 2004 - Wiley Online Library
     
    7. Crystal structures of human bifunctional enzyme ATIC in complex with potent sulfonyl-containing antifolates
    CG Cheong, DW Wolan, SE Greasley - Journal of Biological , 2004 - ASBMB
     
    8. Of sequence and structure: Strategies of protein thermostability in evolutionary perspective
    IN Berezovsky, EI Shakhnovich - Arxiv preprint q-bio/0408007, 2004 - arxiv.org
     
    9. Protein Sequence Alignment Analysis by Local Covariation: Coevolution Statistics Detect Benchmark Alignment Errors
    RJ Dickson, GB Gloor - PloS one, 2012 - dx.plos.org
     
    10. Nucleotide and Amino Acid Sequences for Calmodulin Protein Methyltransferase
    RL Houtz, R Magnani, LMA Dirk - US Patent App. 12/757,388, 2010 - Google Patents
     

    Protein Summary

    The TM0293 gene of Thermotoga maritima encodes gamma-glutamyl phosphate reductase (GPR; EC 1.2.1.41), an enzyme that catalyzes the second step of proline biosynthesis, the reversible nicotinamide adenine dinucleotide phosphate (NADPH)-dependent reduction of L-glutamyl phosphate to phosphate and L-glutamate 5-semialdehyde (PubMed:14705032).

    Protein encoded by TM0293 gene has ALDH-like fold (SCOP sunid:53719) with two similar domains (each with 3 layers a/b/a sandwich) with parallel beta-sheet of 5 strands (order 32145).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch