.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o1z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of a glycerophosphodiester phosphodiesterase (GDPD) from Thermotoga maritima (TM1621) at 1.60 A resolution. Proteins 56 167-170 2004
    Site JCSG
    PDB Id 1o1z Target Id 283478
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1305,TM1621 Molecular Weight 25700.10 Da.
    Residues 222 Isoelectric Point 5.18
    Sequence mivlghrgysakylentleafmkaieagangveldvrlskdgkvvvshdedlkrlfgldvkirdatvse lkeltdgkittlkevfenvsddkiinieikereaadavleiskkrknlifssfdldlldekfkgtkygy lideenygsienfvervekerpyslhvpyqafeleyavevlrsfrkkgivifvwtlndpeiyrkirrei dgvitdevelfvklr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.18
    Matthews' coefficent 2.22 Rfactor 0.139
    Waters 422 Solvent Content 44.16

    Pathway

    Reactions found in Metabolic Reconstruction for TM1621

    Name: Glycerophosphodiester phosphodiesterase (Glycerophosphocholine)
    Metabolic Subsystem: Glycerophospholipid Metabolism
    Reaction: : g3pc + h2o --> chol + glyc3p + h
    Classification: EC:3.1.4.46
     
    Name: Glycerophosphodiester phosphodiesterase (Glycerophosphoethanolamine)
    Metabolic Subsystem: Glycerophospholipid Metabolism
    Reaction: : g3pe + h2o --> etha + glyc3p + h
    Classification: EC:3.1.4.46
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM1621 gene of Thermotoga maritima encodes a glycerophosphodiester phosphodiesterase (GDPD; EC: 3.1.4.46;  Pfam03009; PubMed:15162496).

    Protein encoded by TM1621 gene has TIM beta/alpha-barrel fold (SCOP sunid:51350) and belongs to family of glycerophosphoryl diester phosphodiesterases (SCOP sunid:89508).


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch