| Title | Crystal structure of a ribose-5-phosphate isomerase RpiB (TM1080) from Thermotoga maritima at 1.90 A resolution. Proteins 56 171-175 2004 | | Site | JCSG | | PDB Id | | Target Id | 282947 | | Molecular Characteristics | | Source | Thermotoga maritima msb8 | | Alias Ids | TPS1258,TM1080 | Molecular Weight | 15866.34 Da. | | Residues | 143 | Isoelectric Point | 6.42 | | Sequence | mkiaiasdhaafelkekvknyllgkgievedhgtyseesvdypdyakkvvqsilsneadfgillcgtgl gmsiaanryrgiraalclfpdmarlarshnnanilvlpgrligaelafwivdtflstpfdggrherrir kidev | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.90 | Rfree | 0.138 | | Matthews' coefficent | 2.56 | Rfactor | 0.117 | | Waters | 212 | Solvent Content | 51.52 |
| Pathway | | Reactions found in Metabolic Reconstruction for TM1080 | Name: ribose-5-phosphate isomerase
Metabolic Subsystem: Pentose Phosphate Pathway
Reaction: :
r5p
Name:alpha-D-Ribose 5-phosphate
Formula:C5H9O8P
KEGG:
C00117
<==>
ru5p-D
Name:D-Ribulose 5-phosphate
Formula:C5H9O8P
KEGG:
C00199
Classification: EC:5.3.1.6
|
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The TM1080 gene of Thermotoga maritima encodes the NP_228886 protein, a ribose-5-phosphate isomerase (RpiB; COG0698; pfam02502), that catalyzes the conversion of D-ribose 5-phosphate to D-ribulose 5-phosphate.
TM1080 has ribose/galactose isomerase RpiB/AlsB fold (SCOP sunid:89622) with 3 layers (a/b/a) sandwich, where parallel beta-sheet of 5 strands has a novel 21354 topology. The active site of TM1080 is likely to be located near the crevice formed at the C-terminal ends of strands beta-1, beta-3 and beta-5, which would place the active site at the dimer interface (PubMed:15162497). DALI provides the highest Z-score (27) with phosphate isomerases like PDB:3he8, PDB:2vvr, PDB:1nn4.
Ligand Summary
References
