.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o13

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of probable NifB protein that is involved in FeMo-Co biosynthesis TM1816 from Thermotoga maritima at 1.83 A resolution. To be published
    Site JCSG
    PDB Id 1o13 Target Id 283669
    Related PDB Ids 1t3v 
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1317,TM1816 Molecular Weight 13624.70 Da.
    Residues 124 Isoelectric Point 6.18
    Sequence miiaipvsenrgkdspisehfgrapyfafvkvknnaiadisveenplaqdhvhgavpnfvkekgaelvi vrgigrraiaafeamgvkvikgasgtveevvnqylsgqlkdsdyevhdhhhhehh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.83 Rfree 0.241
    Matthews' coefficent 2.20 Rfactor 0.207
    Waters 96 Solvent Content 43.55

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene TM1816 from Thermotoga maritima encodes a putative dinitrogenase iron-molybdenum cofactor PF02579. This conserved domain belongs to a family of iron-molybdenum cluster-binding proteins that includes NifX, NifB, and NifY, all of which are involved in the synthesis of an iron-molybdenum cofactor (FeMo-co) that binds the active site of the dinitrogenase enzyme. This domain is present either as a stand-alone domain (e.g. NifX and NifY) or fused to another conserved domain (e.g. NifB) however, its function is still undetermined.  The SCOP database suggests that this domain is most similar to structures within the ribonuclease H superfamily SCOP53146.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch