.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o12

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of N-acetylglucosamine-6-phosphate deacetylase (TM0814) from Thermotoga maritima at 2.5 A resolution. To be published
    Site JCSG
    PDB Id 1o12 Target Id 282684
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1236,TM0814 Molecular Weight 40200.31 Da.
    Residues 364 Isoelectric Point 5.59
    Sequence mivekvlivdpidgeftgdveieegkivkvekreciprgvlmpgfvdphihgvvgadtmncdfsemeef lysqgvttflattvstslekmkeilrkardyilenpstsllgvhlegpyiskekkgahsekhirppser elseidspakmltfapeiesselllrlvkrdivlsaghsiatfeefmkfykegvkrithfpnglkplhh reigitgaglllddvklelicdgvhlsremvklvykvkkangivlvtdsisaaglkdgtttlgdlvvkv kdgvprledgtlagstlffsqavknfrkftgcsitelakvssynscvelglddrgriaegtradlvlld edlnvvmtikegevvfrsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.251
    Matthews' coefficent 2.64 Rfactor 0.195
    Waters 206 Solvent Content 52.99

    Pathway

    Reactions found in Metabolic Reconstruction for TM0814

    Name: N-acetylglucosamine-6-phosphate deacetylase (reversible)
    Metabolic Subsystem: Aminosugar Metabolism
    Reaction: : acgam6p + h2o <==> ac + gam6p
    Classification: EC:3.5.1.25
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM0814 gene from Thermotoga maritima encodes N-acetylglucosamine-6-phosphate deacetylase, a member of aminohydrolase family, a subset of metal-dependent hydrolases superfamily PF01979 COG1834.  The enzyme includes the catalytic domain of urease alpha subunit homologous to that from Klebsiella aerogenes [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. Jabri E, Carr MB, Hausinger RP, and Karplus PA The crystal structure of urease from Klebsiella aerogenes. Science. 1995 May 19; 268(5213):998-1004 PubMed HubMed pmid:7754395.

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch