.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

 

T. maritima Browser

TOPSAN > Proteins > JCSG > 1o0x

1o0x

    Page last modified 22:50, 25 Oct 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of a methionine aminopeptidase (TM1478) from Thermotoga maritima at 1.9 A resolution. Proteins 56 396-400 2004
    Site JCSG
    PDB Id 1o0x Target Id 283335
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1292,TM1478 Molecular Weight 27487.50 Da.
    Residues 250 Isoelectric Point 6.62
    Sequence miriktpseiekmkkagkavavalrevrkvivpgktawdvetlvleifkklrvkpafkgyggykyatcv svneevvhglplkekvfkegdivsvdvgavyqglygdaavtyivgetdergkelvrvtrevlekaikmi kpgirlgdvshciqetvesvgfnvirdyvghgvgrelhedpqipnygtpgtgvvlrkgmtlaiepmvse gdwrvvvkedgwtavtvdgsrcahfehtilitengaeiltkeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.254
    Matthews' coefficent 2.47 Rfactor 0.203
    Waters 195 Solvent Content 50.14

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM1478 gene of Thermotoga maritima encodes a methionine aminopeptidase (MAP; EC 3.4.11.18, PubMed:15211524, cd01086), that removes the ubiquitous N-terminal methionine from nascent proteins.  Methionine aminopeptidases are target proteins for the development of both anticancer and antibacterial compounds (PubMed:16420038).

    Protein encoded by TM1478 has creatinase/aminopeptidase fold (SCOP sunid:55919) with duplication composed of two very similar alpha+beta folds.


    Ligand Summary



    References

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch