.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o0w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of Ribonuclease III (TM1102) from Thermotoga maritima at 2.0 A resolution. To be published
    Site JCSG
    PDB Id 1o0w Target Id 282968
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1261,TM1102 Molecular Weight 27528.99 Da.
    Residues 240 Isoelectric Point 5.20
    Sequence mneserkiveefqketginfkneellfralchssyaneqnqagrkdvesnekleflgdavlelfvceil ykkypeaevgdlarvksaaaseevlamvsrkmnlgkflflgkgeektggrdrdsiladafeallaaiyl dqgyekikelfeqefefyiekimkgemlfdyktalqeivqsehkvppeyilvrtekndgdrifvvevrv ngktiatgkgrtkkeaekeaariayekllkers
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.23
    Matthews' coefficent 2.23 Rfactor 0.195
    Waters 383 Solvent Content 44.32

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene TM1102 from Thermotoga maritima encodes ribonuclease III enzyme EC:3.1.26.3.  The enzyme has two domains belonging to distinct superfamilies.  The N-terminal domain encodes ribonuclease III domain PF00636, while the C-terminal domain contains the double-stranded RNA binding motif (DsRBD) PF00035. The ribonuclease III catalyzes the digestion of double-stranded RNA. It is involved in the processing of ribosomal RNA precursors and of some mRNAs [Ref].  The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [Ref]. It is involved in localisation of at least five different mRNAs in the early Drosophila embryo and by interferon-induced protein kinase in humans, which is part of the cellular response to dsRNA.

    Ligand Summary



    References

    Reviews

    References

     

    1. Nashimoto H and Uchida H DNA sequencing of the Escherichia coli ribonuclease III gene and its mutations. Mol Gen Genet. 1985; 201(1):25-9 PubMed HubMed pmid:3903434.

       


      Discuss this publication
    2. Burd CG and Dreyfuss G Conserved structures and diversity of functions of RNA-binding proteins. Science. 1994 Jul 29; 265(5172):615-21 PubMed HubMed pmid:8036511.

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch