.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lme

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Structure analysis of peptide deformylases from streptococcus pneumoniae,staphylococcus aureus, thermotoga maritima, and pseudomonas aeruginosa: snapshots of the oxygen sensitivity of peptide deformylase. J.MOL.BIOL. 330 309-321 2003
    Site JCSG
    PDB Id 1lme Target Id 283518
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1309,TM1661 Molecular Weight 19023.15 Da.
    Residues 164 Isoelectric Point 7.82
    Sequence myrirvfgdpvlrkrakpvtkfdenlkktiermietmyhydgvglaapqvgisqrffvmdvgngpvavi npeileidpetevaeegclsfpeifveierskrikvkyqntrgeyveeelegyaarvfqhefdhlngvl iidrispakrlllrkklmdiartvkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.249
    Matthews' coefficent 2.25 Rfactor 0.198
    Waters 103 Solvent Content 45.26

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene TM1661 from Thermotoga maritima encodes  polypeptide or peptide deformylase PF01327 E.C.3.5.1.88.  The protein belongs to the class of alpha and beta (a+b) proteins and reveals peptide deformylase fold type SCOP56419.  The enzyme belongs to a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes.  These enzymes utilize Fe(II) as the catalytic metal ion, which can be replaced with a nickel or cobalt ion with no loss of activity. There are two types of peptide deformylases, types I and II, which differ in structure only in the outer surface of the domain. Because these enzymes are essential only in prokaryotes (although eukaryotic gene sequences have been found), they are a target for a new class of antibacterial agents [Ref].  The crystal structure of homologous enzyme from Plasmodium falciparum (malaria parasite) in complex with peptide-like inhibitor has been reported 1RL4

    Ligand Summary



    References

    Reviews

    References

     

    1. Apfel CM, Locher H, Evers S, Tak獺cs B, Hubschwerlen C, Pirson W, Page MG, and Keck W Peptide deformylase as an antibacterial drug target: target validation and resistance development. Antimicrob Agents Chemother. 2001 Apr; 45(4):1058-64 PubMed HubMed doi:10.1128/AAC.45.4.1058-1064.2001 pmid:11257016.

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch