.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kq3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc.Natl.Acad.Sci.USA 99 11664-11669 2002
    Site JCSG
    PDB Id 1kq3 Target Id 282296
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1203,TM0423 Molecular Weight 39689.39 Da.
    Residues 364 Isoelectric Point 5.17
    Sequence mitttifpgryvqgagainileeelsrfgerafvviddfvdknvlgenffssftkvrvnkqifggecsd eeierlsglveeetdvvvgigggktldtakavayklkkpvvivptiastdapcsalsviytpngefkry lflprnpdvvlvdteivakaparflvagmgdalatwfeaesckqkyapnmtgrlgsmtayalarlcyet lleygvlakrsveeksvtpalekiveantllsglgfesgglaaahaihngltvlenthkylhgekvaig vlaslfltdkprkmieevysfceevglpttlaeigldgvsdedlmkvaekacdknetihnepqpvtskd vffalkaadrygrmrknlt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.189
    Matthews' coefficent 2.30 Rfactor 0.173
    Waters 227 Solvent Content 46.59

    Pathway

    Reactions found in Metabolic Reconstruction for TM0423

    Name: Glycerol dehydrogenase reversible
    Metabolic Subsystem: Alternate Carbon Metabolism
    Reaction: : glyc + nad <==> dha + h + nadh
    Classification: EC:1.1.1.6
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM0423 gene of Thermotoga maritima encodes a zinc-containing glycerol dehydrogenase (EC:1.1.1.6, PFAM:PF00465, COG:COG0371) that catalyzes the oxidation of glycerol to dihydroxyacetone with the simultaneous reduction of oxidized nicotinamide adenine dinucleatide (NAD+) to reduced nicotinamide adenine dinucleotide (NADH) (PubMed:12193646). 

    Enzyme similar to TM0423 is Fe-dependent and under anaerobic conditions is involved in dissimilation of glucose, and also has a protective role against oxidative stress in aerobic conditions (PMID:12783863).
    The discovery of a coenzyme B12 independent glycerol dehydratase (similar to TM0423), from Clostridium butyricum should significantly influence the development of an economical vitamin B12-free biological process for the production of 1,3-propanediol (1,3-PD) from renewable resources (PMID:12704244).

    Protein encoded by TM0423 has dehydroquinate synthase-like fold (SCOP sunid:56795) with 2 domains: 1st  - alpha/beta of a Rossmann-fold topology that binds NAD, and 2nd - multihelical array. This protein belongs to protein family of iron-containing alcohol dehydrogenases (SCOP sunid:69892). TM0423 has both sequence (FFAS03) and structural (FATCAT) similarity to several structures (i.e.: PDB:1jpuA, PDB:1ta9A, PDB:2bi4A, PDB:1vljA, PDB:1oj7A,  PDB:1dqsA, PDB:1xagA, and PDB:1ujnA).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch