.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j6r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of Activation (AdoMet binding) domain of Methionine synthase (TM0269) from Thermotoga maritima at 2.2 A resolution. To be published
    Site JCSG
    PDB Id 1j6r Target Id 282146
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1196,TM0269 Molecular Weight 22889.11 Da.
    Residues 202 Isoelectric Point 5.13
    Sequence mpkveiapseikipdnvlkaklgfggaeeipeefrktvnrayeelldaakpvvlwrdfevdgslsfddm rltgelatkhlsgskiitvflatlgkkvdekieeyfrkgedllaffidgiasemveyalrkvdaelrmk rsnlegsfrispgygdlplslnkkiaeifkeevdvnviedsyvlvprktitafvgwreknekqt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.29
    Matthews' coefficent 2.99 Rfactor 0.251
    Waters 103 Solvent Content 58.81

    Pathway

    Reactions found in Metabolic Reconstruction for TM0269

    Name: methionine synthase
    Other genes that carryout this rxn: TM0268
    Metabolic Subsystem: Methionine Metabolism
    Reaction: : 5mthf + hcys-L --> h + met-L + thf
    Classification: EC:2.1.1.13
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM0269 gene from Thermotoga maritima encodes the activation domain of a vitamin B12-dependent methionine synthase (PFAM:PF02965, GO:0008705). The structure adopts a methionine synthase activation domain-like fold

     

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch