| Title | Crystal structure of Metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (TM0936) from Thermotoga maritima at 1.9 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 282805 | | Molecular Characteristics | | Source | Thermotoga maritima msb8 | | Alias Ids | TPS1248,TM0936 | Molecular Weight | 45770.12 Da. | | Residues | 406 | Isoelectric Point | 5.15 | | Sequence | miignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvmpalfnththapmtllrgvaed lsfeewlfskvlpiedrltekmayygtilaqmemarhgiagfvdmyfheewiakavrdfgmralltrgl vdsngddggrleenlklynewngfegrifvgfgphspylcseeylkrvfdtakslnapvtihlyetske eydledilniglkevktiaahcvhlperyfgvlkdipffvshnpasnlklgngiapvqrmiehgmkvtl gtdgaasnnslnlffemrlasllqkaqnprnldvntclkmvtydgaqamgfksgkieegwnadlvvidl dlpemfpvqniknhlvhafsgevfatmvagkwiyfdgeyptidseevkrelariekelyss | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.90 | Rfree | 0.202 | | Matthews' coefficent | 3.16 | Rfactor | 0.175 | | Waters | 174 | Solvent Content | 61.10 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
TM0936 has a fold typical for a amidohydrolase superfamily (AHS), consisting of two domains, a TIM barrel and a beta roll.
TM0936 is a S-adenosylhomocysteine (SAH) deaminase, part of a novel and as yet uncharacterized pathway of SAH degradation, as recently demonstrated in Hermann JC, Marti-Arbona R, Fedorov AA, Fedorov E, Almo SC, Shoichet BK, Raushel FM. "Structure-based activity prediction for an enzyme of unknown function." Nature. 2007 448:775-9
Ligand Summary
The JCSG structure was solved without a ligand. Subsequently, a complex of TM0936 with methionine (1p1m) was solved by the
New York Structural GenomiX Research Consortium (NYSGXRC) and a complex with the product resulting from the deamination of SAH, S-inosylhomocysteine was solved by the Frank M. Raushel group at Texas A&M (2plm).
References