.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j6p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of Metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (TM0936) from Thermotoga maritima at 1.9 A resolution. To be published
    Site JCSG
    PDB Id 1j6p Target Id 282805
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1248,TM0936 Molecular Weight 45770.12 Da.
    Residues 406 Isoelectric Point 5.15
    Sequence miignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvmpalfnththapmtllrgvaed lsfeewlfskvlpiedrltekmayygtilaqmemarhgiagfvdmyfheewiakavrdfgmralltrgl vdsngddggrleenlklynewngfegrifvgfgphspylcseeylkrvfdtakslnapvtihlyetske eydledilniglkevktiaahcvhlperyfgvlkdipffvshnpasnlklgngiapvqrmiehgmkvtl gtdgaasnnslnlffemrlasllqkaqnprnldvntclkmvtydgaqamgfksgkieegwnadlvvidl dlpemfpvqniknhlvhafsgevfatmvagkwiyfdgeyptidseevkrelariekelyss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.202
    Matthews' coefficent 3.16 Rfactor 0.175
    Waters 174 Solvent Content 61.10

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    TM0936 has a fold typical for a amidohydrolase superfamily (AHS), consisting of two domains, a TIM barrel and a beta roll.

    TM0936 is a S-adenosylhomocysteine (SAH) deaminase, part of a novel and as yet uncharacterized pathway of SAH degradation, as  recently demonstrated in Hermann JC, Marti-Arbona R, Fedorov AA, Fedorov E, Almo SC, Shoichet BK, Raushel FM.   "Structure-based activity prediction for an enzyme of unknown function." Nature. 2007 448:775-9

    Ligand Summary

    The JCSG structure was solved without a ligand. Subsequently, a complex of TM0936 with methionine (1p1m) was solved by the New York Structural GenomiX Research Consortium (NYSGXRC) and a complex with the product resulting from the deamination of SAH, S-inosylhomocysteine was solved by the Frank M. Raushel group at Texas A&M (2plm).

    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch