| Title | Crystal structure of TatD-related deoxyribonuclease (TM0667) from Thermotoga maritima at 1.8 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 282539 | | Molecular Characteristics | | Source | Thermotoga maritima msb8 | | Alias Ids | TPS1225,TM0667 | Molecular Weight | 29179.67 Da. | | Residues | 256 | Isoelectric Point | 5.23 | | Sequence | mvdthahlhfhqfdddrnavissfeenniefvvnvgvnledskksldlsktsdrifcsvgvhphdakev pedfiehlekfakdekvvaigetgldffrnispaevqkrvfveqielagklnlplvvhirdayseayei lrteslpekrgvihafssdyewakkfidlgfllgiggpvtypknealrevvkrvgleyivletdcpflp pqpfrgkrnepkylkyvvetisqvlgvpeakvdeattenarriflevke | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.80 | Rfree | 0.224 | | Matthews' coefficent | 1.78 | Rfactor | 0.19 | | Waters | 195 | Solvent Content | 30.36 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
Thermotoga maritima TM_0667 protein is a TatD-related deoxyribonuclease (PFAM family PF01026), with a classical TIM-like fold, a member of the metallo-dependent hydrolases SCOP superfamily which all share a similar type of distortion of the beta barrel. TM_0667 was the first solved structure from this family, since its deposition in 2002, reveral other related proteins were solved by other SG production centers - 1wxy, 1yix, 1zmm (NYSGXRC) and 2gzx (NECSG)
Ligand Summary
References
