.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j5y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a transcription regulator (TM1602) from Thermotoga maritima at 2.3 A resolution. Proteins 67 247-252 2007
    Site JCSG
    PDB Id 1j5y Target Id 283459
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1303,TM1602 Molecular Weight 19553.78 Da.
    Residues 175 Isoelectric Point 6.01
    Sequence mhmktvrqerlksivrilerskepvsgaqlaeelsvsrqvivqdiaylrslgynivatprgyvlaggks gvsrlvavkhapeeikeellcvvrnggrivdvivehpvygeirgiidvsseeevlkfvnlmemaktepl ltlsggvhlhtieapdeetmerimrelkkkgflieeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.234
    Matthews' coefficent 3.20 Rfactor 0.19
    Waters 97 Solvent Content 61.25

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This protein is proposed to contain a 3-histidine (3H) domain, named after its three highly conserved histidines, and a DNA-binding domain. It represents the first structure of a 3H protein family member. Based on sequence analysis, its function has been postulated to involve binding of small molecules. Recent experimental data support this prediction, suggesting that it belongs to a family of de novo NAD synthesis pathway regulators that may bind to nicotinamide, nicotinic acid, or other substrate/products. When activated by these small molecules, it is proposed to bind to the NAD promoter region to repress the de novo NAD biosynthesis operon. This pathway has been well characterized in the TM1602 homologous protein, yrxA, from Bacillus subtilis. Experimental characterization of this protein is now in progress [Rodionov & Osterman].[Ref]

    Ligand Summary

    Reviews

    References

     

    1. Weekes D, Miller MD, Krishna SS, McMullan D, McPhillips TM, Acosta C, Canaves JM, Elsliger MA, Floyd R, Grzechnik SK, Jaroszewski L, Klock HE, Koesema E, Kovarik JS, Kreusch A, Morse AT, Quijano K, Spraggon G, van den Bedem H, Wolf G, Hodgson KO, Wooley J, Deacon AM, Godzik A, Lesley SA, and Wilson IA Crystal structure of a transcription regulator (TM1602) from Thermotoga maritima at 2.3 A resolution. Proteins. 2007 Apr 1; 67(1):247-52 PubMed HubMed doi:10.1002/prot.21221 pmid:17256761.

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch