.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j5x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of Glucosamine-6-phosphate deaminase (TM0813) from Thermotoga maritima at 1.8 A resolution. To be published
    Site JCSG
    PDB Id 1j5x Target Id 282683
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1235,TM0813 Molecular Weight 37369.23 Da.
    Residues 330 Isoelectric Point 5.75
    Sequence msktlkeitdqknelkkffenfvlnlekteifseiqknltdevlfvgcgssynlaltisyyfervlkir tkaipagevafqkipdleerglaflfsrtgnttevllandvlkkrnhrtigitieeesrlakesdlplv fpvreeaivmtksfsmillslmfladkiagnsterfselvgyspeffdiswkviekidlkehdhfvflg mseffgvslesalkciemsltfseaystleyrhgpkalvkkgtlvfmqkvsgmdeqekrlrkeleslga tvlevgeggdipvsndwksaflrtvpaqilgyqkaisrgispdkpphlektvvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.231
    Matthews' coefficent 2.51 Rfactor 0.192
    Waters 294 Solvent Content 50.60

    Pathway

    Reactions found in Metabolic Reconstruction for TM0813

    Name: glucosamine-6-phosphate deaminase reversible
    Metabolic Subsystem: Aminosugar Metabolism
    Reaction: : gam6p + h2o <==> f6p + nh4
    Classification: EC:3.5.99.6
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM0813 gene from Thermotoga maritima encodes a glucosamine-6-phosphate deaminase (PF01380, COG0449, EC 3.5.99.6). The TM0813 structure adopts a SIS (Sugar ISomerase) domain fold and shows strong similarity (main-chain rmsd of 1.8 Å over 291 residues with a sequence identity of 32%) with a glucosamine-6-phosphate deaminase from two other hyperthermophiles, Pyrococcus horikoshii (PDB ids: 2e5f, 2df8, 2dec) and Pyrococcus furiosus (2cb0) (Kim 2007). Similar results were obtained for a homolog from Listeria monocytogenes (PDB id: 2aml).

     

    [SIS domain fold family contains 3 children: mono-SIS, double-SIS and phosphoglucose isomerase (PGI) SIS. TM0813 is part of the double-SIS group along with 1wiw, 1tzb, 1tzc, 1x9i, 1x9h and others. Look at fold vs function variants]

     

    [Compare active site residues with 2cb0]

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch