.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j5w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of Glycyl-tRNA synthetase alpha chain (TM0216) from Thermotoga maritima at 1.95 A resolution. To be published
    Site JCSG
    PDB Id 1j5w Target Id 282096
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1193,TM0216 Molecular Weight 33538.30 Da.
    Residues 286 Isoelectric Point 4.99
    Sequence mylqdvimklndfwaskgclleqpydmevgagtfhpatffgslrkgpwkvayvqpsrrptdgrygenpn rlqryfqyqviikpspensqelylesleylginlkehdirfvednwesptlgawgvgwevwldgmeitq ftyfqqiggislkdipleitygleriamylqgvdnvyevqwnenvkygdvflenerefsvfnfeeanvg llfrhfdeyekefyrlveknlylpaydyilkcshtfnlldargaisvsqrqtyvkriqamarkaarvfl evqanenspa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.254
    Matthews' coefficent 2.27 Rfactor 0.197
    Waters 255 Solvent Content 45.49

    Pathway

    Reactions found in Metabolic Reconstruction for TM0216

    Name: Glycyl-tRNA synthetase
    Other genes that carryout this rxn:TM0217
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : atp + gly + trnagly --> amp + glytrna + ppi
    Classification: EC:6.1.1.14
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    The TM0216 from Thermotoga maritima codes for glycyl-tRNA synthetase alpha chain.  The enzyme belongs to a family of class II tRNA synthetases PF02091.  The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II COG0752.  These proteins differ widely in size and oligomeric state, and have limited sequence homology [Ref].  However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases.  In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred.

    Ligand Summary



    References

    Reviews

    References

     

    1. Eriani G, Delarue M, Poch O, Gangloff J, and Moras D Partition of tRNA synthetases into two classes based on mutually exclusive sets of sequence motifs. Nature. 1990 Sep 13; 347(6289):203-6 PubMed HubMed doi:10.1038/347203a0 pmid:2203971.

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch