.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j5u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of archease, possible chaperone (TM1083) from Thermotoga maritima at 2.0 A resolution. To be published
    Site JCSG
    PDB Id 1j5u Target Id 282950
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1259,TM1083 Molecular Weight 14664.90 Da.
    Residues 124 Isoelectric Point 4.85
    Sequence mrkpiehtadiayeisgnsyeelleearnilleeegivldteekekmypleetedaffdtvndwileis kgwapwrikregnelkvtfrkirkkegteikaltyhllkferdgdvlktkvvfdt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.271
    Matthews' coefficent 2.93 Rfactor 0.212
    Waters 118 Solvent Content 57.74

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM1083 gene from Thermotoga maritima encodes a protein of unkown function (DUF101 (PF01951), COG1371). The family has a wide phylogenetic distribution, encountered in archaea, viruses, fungi, insects (moth, mosquito, fruit fly), nematodes, fish and mammals including humans. The TM1083 structure adopts a novel fold termed MTH1598-like fold and shows strong similarity (2.6 Å main-chain rmsd over 112 residues with 20% sequence identity; Dali Zscr=10) to another DUF101 homolog from Methanothermobacter thermoautotrophicus (PDB id: 1jw3) from which the fold takes its name. Both structures comprise a single domain with two helices in the center flanked by short beta-sheets at both ends. This arrangement is reminiscent of BTB/POZ domains which have been described in a wide range of organisms as protein-protein interactions modules (Perez-Torrado 2006) with a role in the regulation of DNA transcription. Structural analysis of 1jw3 shows similarity to heat-shock protein 33 (PDB id: 1i7f; Dali Z=4) and suggests a function in RNA binding (Yee 2002) with bioinformatics analysis predicting a role as chaperone or modulators of proteins involved in DNA or RNA processing (Canaves 2004).

    The genetic neighborhood of TM1083 shows with a high probability a functional association with a LexA repressor (EC 3.4.21.88), DNA gyrase subunit A (EC 5.99.1.3), a putative anti-sigma factor antagonist (TM1081), a methionyl-tRNA synthetase (EC 6.1.1.10) and a ribosomal protein L11 methyltransferase, suggesting an involvement in regulation of DNA transcription. A similar neighborhood is observed for MTH1598 and shows cooccurrence with a DNA polymerase sliding clamp.

    RNA interference experiments have shown the C. elegans DUF101 homolog to be implicated in larval arrest and genitalia development. Yeast-two-hybrid experiments in the D. melanogaster DUF101 homolog have shown physical interactions with a stress-response chaperone (DnaJ-1), proteins involved in translation-elongation and ribosomes (Ef1-gamma, RpS7, SnrB) and a protein located on the germline ring canal involved in germ-line cyst encapsulation (cher).

     

     

    [Any data on whether or not 1j5u forms a dimer in solution?]

    [electrostatics? look for hydrophobic patch that might indicate area of protein-protein interactions]

    [Describe structural differences between 1j5u and 1jw3, including conformational change in the presence of calcium.]

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch