.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

Page Authors

 

T. maritima Browser

TOPSAN > Proteins > JCSG > 1j5s

1j5s

    Page last modified 22:11, 25 Oct 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of uronate isomerase (TM0064) from Thermotoga maritima at 2.85 A resolution. Proteins 53 142-145 2003
    Site JCSG
    PDB Id 1j5s Target Id 281945
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1179,TM0064 Molecular Weight 52303.03 Da.
    Residues 451 Isoelectric Point 5.68
    Sequence mflgedylltnraavrlfnevkdlpivdphnhldakdivenkpwndiwevegatdhyvwelmrrcgvse eyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpqk llrdmkveilcttddpvstlehhrkakeavegvtilptwrpdramnvdkegwreyvekmgerygedtst ldgflnalwkshehfkehgcvasdhallepsvyyvdenraravhekafsgekltqdeindykafmmvqf gkmnqetnwvtqlhigalrdyrdslfktlgpdsggdistnflriaeglryflnefdgklkivlyvldpt hlptistiarafpnvyvgapwwfndspfgmemhlkylasvdllynlagmvtdsrkllsfgsrtemfrrv lsnvvgemvekgqipikearelvkhvsydgpkalffg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.85 Rfree 0.274
    Matthews' coefficent 2.81 Rfactor 0.234
    Waters 107 Solvent Content 55.94

    Pathway

    Reactions found in Metabolic Reconstruction for TM0064
    Name: glucuronate isomerase (D-glucuronate)
    Metabolic Subsystem: Glucuronate Metabolism
    Reaction: : glcur <==> fruur
    Classification: EC:5.3.1.12
     
    Name: glucuronate isomerase (D-galacturonate)
    Metabolic Subsystem: Pentose and Glucuronate Interconversions
    Reaction: : galur <==> tagur
    Classification: EC:5.3.1.12
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The TM0064 gene of Thermotoga maritima encodes a predicted uronate isomerase (EC:5.3.1.12; COG:COG1904; PFAM:PF02614). This enzyme catalyses the reactions: D-glucuronate <=> D-fructuronate and D-galacturonate <=> D-tagaturonate.

     

    1j5s structure folds into a TIM beta/alpha-barrel (SCOP sunid:51350) with all-alpha subdomain inserted after the first strand. The all-alpha subdomain has a novel fold, unique for uronate isomerase-like family (SCOP sunid:75082) [Ref].

    Ligand Summary



    References

    Reviews References Images Files Tags

    Reviews

    References

     

    1. Schwarzenbacher R, Canaves JM, Brinen LS, Dai X, Deacon AM, Elsliger MA, Eshaghi S, Floyd R, Godzik A, Grittini C, Grzechnik SK, Guda C, Jaroszewski L, Karlak C, Klock HE, Koesema E, Kovarik JS, Kreusch A, Kuhn P, Lesley SA, McMullan D, McPhillips TM, Miller MA, Miller MD, Morse A, Moy K, Ouyang J, Robb A, Rodrigues K, Selby TL, Spraggon G, Stevens RC, van den Bedem H, Velasquez J, Vincent J, Wang X, West B, Wolf G, Hodgson KO, Wooley J, and Wilson IA Crystal structure of uronate isomerase (TM0064) from Thermotoga maritima at 2.85 A resolution. Proteins. 2003 Oct 1; 53(1):142-5 PubMed HubMed doi:10.1002/prot.10462 pmid:12945057.

       


      Discuss this publication
    Add tag
    Tag page
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch