.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zgc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Packing Mediates Enantioselective Ligand Recognition at the Peripheral Site of Acetylcholinesterase. J.Am.Chem.Soc. 127 11029-11036 2005
    Site ISPC
    PDB Id 1zgc Target Id W00567
    Molecular Characteristics
    Source Torpedo californica
    Alias Ids TPS11954,P04058 Molecular Weight 65902.66 Da.
    Residues 586 Isoelectric Point 5.72
    Sequence mnllvtsslgvllhlvvlcqaddhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrp epkkpwsgvwnastypnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiyg ggfysgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdniqf fggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrrravelgrnlncn lnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffptslesmlnsgnfkktqillgvn kdegsffllygapgfskdseskisredfmsgvklsvphandlgldavtlqytdwmddnngiknrdgldd ivgdhnvicplmhfvnkytkfgngtylyffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaee ealsrrimhywatfaktgnpnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkl lnatacdgelsssgtssskgiifyvlfsilylif
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.247
    Matthews' coefficent 2.99 Rfactor 0.196
    Waters 341 Solvent Content 58.84

    Ligand Information
    Ligands NAG (N-ACETYL-D-GLUCOSAMINE) x 5;A2E ((5S)-5-{[10-(1,2,3,4-TETRAHYDROACRIDIN-9-YLAMINO)) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch