| Title | The modular architecture of protein-protein binding interfaces. Proc.Natl.Acad.Sci.USA 102 57-62 2005 | | Site | ISPC | | PDB Id | | Target Id | W00187 | | Molecular Characteristics | | Source | Streptomyces calvalugarus | | Alias Ids | TPS11911,P35804, P00810 | Molecular Weight | 17465.53 Da. | | Residues | 165 | Isoelectric Point | 5.85 | | Sequence | agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgftsaaadakvds ksqekllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypaypstagvtlslscfdvdgys stgayrgsahlwftdgvlqgkrqwdlv | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.30 | Rfree | | | Matthews' coefficent | 2.46 | Rfactor | 0.212 | | Waters | 393 | Solvent Content | 49.93 |
| Ligand Information | | Ligands | | | Metals | CA (CALCIUM) x 2 | | |
