| Title | The crystal structure of the toxin-antitoxin complex RelBE2 (Rv2865-2866) from Mycobacterium tuberculosis. To be Published | | Site | ISFI | | PDB Id | | Target Id | ISFI121 | | Molecular Characteristics | | Source | Mycobacterium tuberculosis | | Alias Ids | TPS28086, | Molecular Weight | 10236.32 Da. | | Residues | 87 | Isoelectric Point | 11.02 | | Sequence | mpytvrftttarrdlhklpprilaavvefafgdlsreplrvgkplrrelagtfsarrgtyrllyridde httvvilrvdhradiyrr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.00 | Rfree | 0.24553 | | Matthews' coefficent | 2.71 | Rfactor | 0.20247 | | Waters | 173 | Solvent Content | 54.53 |
| Ligand Information | | Ligands | SCN (THIOCYANATE) x 1;GOL (GLYCEROL) x 1;IMD (IMIDAZOLE) x 1;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1 | | Metals | CL (CHLORIDE) x 1 | | |
