| Title | Structure and function of Bacillus subtilis YphP, a prokaryotic disulfide isomerase with a CXC catalytic motif . Biochemistry 48 8664-8671 2009 | | Site | ISFI | | PDB Id | | Target Id | ISFI308 | | Molecular Characteristics | | Source | Bacillus subtilis | | Alias Ids | TPS28090, | Molecular Weight | 15874.22 Da. | | Residues | 144 | Isoelectric Point | 4.81 | | Sequence | msmayeeymrqlvvpmrreltgagfeelttaeevenfmekaegttlvvvnsvcgcaaglarpaatqavl qndktpdntvtvfagqdkeatakmreyftgqepsspsmallkgkevvhfiprheieghdmeeimknlta afdahc | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.30 | Rfree | 0.2464 | | Matthews' coefficent | 2.73 | Rfactor | 0.1899 | | Waters | 249 | Solvent Content | 54.98 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 12 | | Metals | | | |
