| Title | Crystal structure of putative metal-dependent hydrolases APC36150. To be Published | | Site | ISFI | | PDB Id | | Target Id | ISFI154 | | Molecular Characteristics | | Source | Bacillus stearothermophilus | | Alias Ids | TPS28088, | Molecular Weight | 17953.61 Da. | | Residues | 154 | Isoelectric Point | 6.79 | | Sequence | msrakkwvqyflshrhvtmelihkideahydykptptsmtakqlathmlfsfynfantakhgdpslfrq kieepetnlaklaetytektrqliesmsdddfdrtldltaifgtqmstaqflqlamdheihhkgqlfvy vrgmghtdlplfvkrg | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.51 | Rfree | 0.259 | | Matthews' coefficent | 2.02 | Rfactor | 0.177 | | Waters | 59 | Solvent Content | 39.22 |
| Ligand Information | | Ligands | | | Metals | NI (NICKEL) x 4 | | |
