| Title | Solution Structure of OMPR-C DNA Binding Protein. To be Published | | Site | ISFI | | PDB Id | | Target Id | ISFI333 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS11927, | Molecular Weight | 11878.11 Da. | | Residues | 104 | Isoelectric Point | 9.16 | | Sequence | aviafgkfklnlgtremfredepmpltsgefavlkalvshpreplsrdklmnlargreysamersidvq isrlrrmveedpahpryiqtvwglgyvfvpdgska | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
