| Title | Toward the structural genomics of complexes: Crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc.Natl.Acad.Sci.Usa 103 8060-8065 2006 | | Site | TBSGC | | PDB Id | | Target Id | Rv2431c | | Molecular Characteristics | | Source | | | Alias Ids | TPS11923,57116989, Q7D756, 57116989, YP_177882.1 | Molecular Weight | 10686.51 Da. | | Residues | 99 | Isoelectric Point | 5.76 | | Sequence | msfvitnpealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyarkyrqtiaaa avvleefahalttgadkyataeadniktfs | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.20 | Rfree | 0.31181 | | Matthews' coefficent | 2.04 | Rfactor | 0.24719 | | Waters | 72 | Solvent Content | 39.70 |
| Ligand Information | | Ligands | | | Metals | MN (MANGANESE) x 2 | | |
