| Title | Crystal structure of a putative organic hydroperoxide resistance protein with molecule of captopril bound in one of the active sites from Vibrio cholerae O1 biovar eltor str. N16961. TO BE PUBLISHED |
| Site | CSGID |
| PDB Id | | Target Id | IDP01325 |
| Related PDB Ids 3eer 3i07 |
| Molecular Characteristics |
| Source | Vibrio cholerae o1 biovar el tor str. n16961 |
| Alias Ids | TPS24737,243277, 15601759 | Molecular Weight | 15056.23 Da. |
| Residues | 145 | Isoelectric Point | 6.27 |
| Sequence | mrnknmstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavgyaacfsnailhv areakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlvtvahqvcpysnavrgnidvqv svnglal |
| | BLAST FFAS |
