| Title | Crystal Structure of CBS Domain-containing Protein of Unknown Function from Bacillus anthracis str. Ames Ancestor. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP02609 | | Molecular Characteristics | | Source | Bacillus anthracis str. ames ancestor | | Alias Ids | TPS48420,261594, 47529491 | Molecular Weight | 16757.91 Da. | | Residues | 147 | Isoelectric Point | 5.95 | | Sequence | misipkdefqqifvkdlmissekvahvqignglehallvlvksgysaipvldpmyklhglistamildg ilglerieferleemkveqvmkqdipvlkledsfakalemtidhpficavnedgyfegiltrrailkll nkkvrqhnr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.80 | Rfree | 0.2376 | | Matthews' coefficent | 1.95 | Rfactor | 0.1839 | | Waters | 103 | Solvent Content | 37.06 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 6;FMT (FORMIC) x 4;GOL (GLYCEROL) x 1 | | Metals | | | |
