| Title | Structure of the type III effector/phosphothreonine lyase OspF from Shigella flexneri. TO BE PUBLISHED | | Site | CSGID | | PDB Id | | Target Id | IDP90224 | | Molecular Characteristics | | Source | Shigella flexneri 2a str. 301 | | Alias Ids | TPS31320,198214, 31983551 | Molecular Weight | 27826.32 Da. | | Residues | 239 | Isoelectric Point | 7.61 | | Sequence | mpikkpclklnldslnvvrseipqmlsanerlknnfnilynqirqypayyfkvasnvptysdicqsfsv myqgfqivnhsgdvfihacrenpqskgdfvgdkfhisiareqvplafqilsgllfsedspidkwkitdm nrvsqqsrvgigaqftlyvksdqecsqysalllhkirqfimclesnllrskiapgeypasdvrpedwky vsyrnelrsdrdgserqeqmlreepfyrlmie | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.70 | Rfree | 0.28726 | | Matthews' coefficent | 2.27 | Rfactor | 0.24968 | | Waters | 6 | Solvent Content | 45.90 |
| Ligand Information | | Ligands | MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 1 | | Metals | | | |
