.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hzn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structure of the Salmonella typhimurium nfnB dihydropteridine reductase. TO BE PUBLISHED
    Site CSGID
    PDB Id 3hzn Target Id IDP00923
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26348,99287, 16763955 Molecular Weight 23953.82 Da.
    Residues 217 Isoelectric Point 5.40
    Sequence mdivsvalqrystkafdpskkltaeeadkiktllqyspsstnsqpwhfivasteegkarvaksaagnyt fnerkmldashvvvfcaktamddawlervvdqedadgrfatpeakaandkgrrffadmhrvslkddhqw makqvylnvgnfllgvaamgldavpiegfdaevldaefglkekgytslvvvpvghhsvedfnaglpksr lplettltev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.40 Rfree 0.222
    Matthews' coefficent 4.55 Rfactor 0.177
    Waters 821 Solvent Content 72.99

    Pathway

    Reactions found in Metabolic Reconstruction for TM0578

    Name: L-hydroxyproline reductase (NADP)
    Metabolic Subsystem: Proline Biosynthesis
    Reaction: : 1p3h5c + h + nadph --> 4hpro-LT + nadp
    Classification: EC:1.5.1.2
     
    Name: pyrroline-5-carboxylase reductase (NADP) reversible
    Metabolic Subsystem: Proline Biosynthesis
    Reaction: : 1pyr5c + h + nadph <==> nadp + pro-L
    Classification: EC:1.5.1.2
     

    Ligand Information
    Ligands TLA (L(+)-TARTARIC) x 7;SIN (SUCCINIC) x 44;MLI (MALONATE) x 19;FLC (CITRATE) x 2;ACT (ACETATE) x 3
    Metals CL (CHLORIDE) x 12;NA (SODIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch