| Title | Crystal Structure of Isopentenyl-Diphosphate delta-Isomerase from Salmonella entericase. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP01970 | | Molecular Characteristics | | Source | Salmonella enterica subsp. enterica serovar typhimurium str. lt2 | | Alias Ids | TPS28078,99287, 16766340 | Molecular Weight | 20780.43 Da. | | Residues | 181 | Isoelectric Point | 5.11 | | Sequence | mteehvvlldeqdkpsgtlekyaahtlntplhlafscwlfnedgqllvtrrslskkawpgvwtnsvcgh pqqgetteeaiirrcrfelgveitdltpvyphfsyratdpngivenevcpvfaaratsvlqvnseevmd yqwsefksvwksllatpwafspwmvmqasdeqarerllnycqr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.52 | Rfree | 0.187 | | Matthews' coefficent | 2.12 | Rfactor | 0.163 | | Waters | 227 | Solvent Content | 41.96 |
| Ligand Information | | Ligands | | | Metals | | | |
