| Title | 2.31 Angstrom resolution crystal structure of a holo-(acyl-carrier-protein) synthase from Bacillus anthracis str. Ames in complex with CoA (3',5'-ADP). To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP01182 | | Molecular Characteristics | | Source | Bacillus anthracis str. ames | | Alias Ids | TPS28064,198094, 61211622 | Molecular Weight | 13099.43 Da. | | Residues | 119 | Isoelectric Point | 6.84 | | Sequence | mivgigidiielnriekmldgklkfmeriltenernvakglkgsrltefvagrfaakeayskavgtgig kevsfldievrnddrgkpilitstehivhlsishskefavaqvvlessss | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 2.31 | Rfree | 0.24654 | | Matthews' coefficent | 2.63 | Rfactor | 0.18962 | | Waters | 266 | Solvent Content | 53.19 |
| Ligand Information | | Ligands | A3P (ADENOSINE-3'-5'-DIPHOSPHATE) x 6 | | Metals | MG (MAGNESIUM) x 9;CL (CHLORIDE) x 6 | | |
