.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hl3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title 2.76 Angstrom Crystal Structure of a Putative Glucose-1-Phosphate Thymidylyltransferase from Bacillus anthracis in Complex with a Sucrose. TO BE PUBLISHED
    Site CSGID
    PDB Id 3hl3 Target Id IDP01254
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS28066,198094, 30255177 Molecular Weight 27500.01 Da.
    Residues 245 Isoelectric Point 6.14
    Sequence mkgiilaggtgsrlypitkvtnkhllpvgrypmiyhavyklkqcditdimiitgkehmgdvvsflgsgq efgvsftyrvqdkaggiaqalglcedfvgndrmvvilgdnifsddirpyveeftnqkegakvllqsvdd perfgvaniqnrkiieieekpkepkssyavtgiylydskvfsyikelkpsargeleitdinnwylkrgv ltynemsgwwtdagthvslqranalardinfgkqfnge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.76 Rfree 0.20573
    Matthews' coefficent 3.67 Rfactor 0.17302
    Waters 37 Solvent Content 66.51

    Ligand Information
    Ligands SUC (SUCROSE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch