| Title | The crystal structure of the adenylosuccinate synthetase from Yersinia pestis CO92. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP00422 | | Molecular Characteristics | | Source | Yersinia pestis co92 | | Alias Ids | TPS28051,214092, 16120713 | Molecular Weight | 47275.50 Da. | | Residues | 432 | Isoelectric Point | 5.38 | | Sequence | mgknvvvlgtqwgdegkgkvvdllterakyvvryqgghnaghtlvingektvlhlipsgilrenvisii gngvvlapdalmkemteleargvpvrerlllseacplilpyhvaldnarekargakaigttgrgigpay edkvarrglrvsdlfnketfaiklkeiveyhnfqlvhyykeaavdyqkvlddvlaiadiltamvvdvse lldnarkqgelimfegaqgtlldidhgtypyvtssnttaggvatgsglgpryvdyvlgivkaystrvga gpfptelndetgeflrkqgneygattgrsrrtgwldivavrravqinslsgfcmtkldvldglkevklc vgyrmpdgrevdttplaaegwegiepiyetmpgwsettfgvkehsklpqaalnyiqrveeltgvpidii stgpdrdetmilrdpfda | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.60 | Rfree | 0.19756 | | Matthews' coefficent | 2.50 | Rfactor | 0.16022 | | Waters | 651 | Solvent Content | 50.74 |
| Ligand Information | | Ligands | PG6 (1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-) x 1 | | Metals | | | |
