| Title | X-ray crystal structure of chaperone HscB from Vibrio cholerae. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP01304 | | Molecular Characteristics | | Source | Vibrio cholerae o1 biovar el tor str. n16961 | | Alias Ids | TPS28068,243277, 15640770 | Molecular Weight | 19626.34 Da. | | Residues | 171 | Isoelectric Point | 4.74 | | Sequence | mnyfelfglpiqfeldgsllssqfralqkrfhpdnfataserdrlmavqqaaqindayqtlkdplrrae yllslqgiemnaeqqtlqdpmflmeqmelreelesvtacadpeaalvafdtkvtamqrhylaqlqgqla qsewlaaadqirklkfiaklknevervedqllg | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.15 | Rfree | 0.235 | | Matthews' coefficent | 2.42 | Rfactor | 0.200 | | Waters | 116 | Solvent Content | 49.27 |
| Ligand Information | | Ligands | | | Metals | CA (CALCIUM) x 6 | | |
