.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h5q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of a putative pyrimidine-nucleoside phosphorylase from Staphylococcus aureus. TO BE PUBLISHED
    Site CSGID
    PDB Id 3h5q Target Id IDP00692
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS26757,93062, 57286344 Molecular Weight 46305.49 Da.
    Residues 433 Isoelectric Point 4.96
    Sequence mrmidiiekkrdghtltteeinffiggyvkgdipdyqasslamaiyfqdmndderaaltmamvnsgdmi dlsdikgvkvdkhstggvgdtttlvlaplvaavdvpvakmsgrglghtggtidkleaidgfhveideat fvklvnenkvavvgqsgnltpadkklyalrdvtgtvnsipliassimskkiaagadaivldvktgsgaf mktledaealahamvrignnvgrntmaiisdmnqplgraignalelqeaidtlkgqgpkdltelvltlg sqmvvlankaetleearallieainsgaalekfktfiknqggdetvidhperlpqaqyqieykakksgy vtelvsndigvasmmlgagrltkeddidlavgivlnkkigdkveegeslltihsnrqdvddvvkkldss itiadhvvsptlihkiite
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.94 Rfree 0.204
    Matthews' coefficent 2.39 Rfactor 0.166
    Waters 406 Solvent Content 48.54

    Ligand Information
    Ligands THM (THYMIDINE) x 1;SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch