| Title | Crystal structure of superoxide dismutase from Francisella tularensis subsp. tularensis SCHU S4. To be Published | | Site | CSGID | | PDB Id | | Target Id | IDP01808 | | Molecular Characteristics | | Source | Francisella tularensis subsp. tularensis schu s4 | | Alias Ids | TPS26804,177416, 56707247 | Molecular Weight | 21938.47 Da. | | Residues | 192 | Isoelectric Point | 5.39 | | Sequence | mkfelpklpyavdalestisketieyhygkhhqtyvtnlnnlvegtehdgrnleeivktsnggifnnaa qvfnhtfywncltpnkteassqlkaalietfgsvenfkeqfskaaiatfgsgwawlvkntegkleivtt snagcpltenkkplltfdvwehayyidyrnarpkyvealwdivnwqfvseqfad | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.90 | Rfree | 0.20502 | | Matthews' coefficent | 2.42 | Rfactor | 0.16485 | | Waters | 252 | Solvent Content | 49.17 |
| Ligand Information | | Ligands | GOL (GLYCEROL) x 3 | | Metals | FE (FE) x 2 | | |
