.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h0p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title 2.0 Angstrom Crystal Structure of an Acyl Carrier Protein S-malonyltransferase from Salmonella typhimurium. TO BE PUBLISHED
    Site CSGID
    PDB Id 3h0p Target Id IDP00956
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26136,99287, 16764549 Molecular Weight 32403.41 Da.
    Residues 309 Isoelectric Point 5.11
    Sequence mtqfafvfpgqgsqsvgmlaemaanypiveetfaeasaalgydlwaltqqgpaeelnktwqtqpallta svalwrvwqqqggkmpalmaghslgeysalvcagvinfadavrlvemrgkfmqeavpegtggmsaiigl ddasiakaceesaegqvvspvnfnspgqvviaghkeaveragaackaagakralplpvsvpshcalmkp aadklavelakitfsaptvpvvnnvdvkcetdaaairdalvrqlynpvqwtksvefiaaqgvehlyevg pgkvltgltkrivdtltasalnepaalsaaltq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.24340
    Matthews' coefficent 2.49 Rfactor 0.18975
    Waters 455 Solvent Content 50.70

    Pathway

    Reactions found in Metabolic Reconstruction for TM1194

    Name: lactose transport via ABC system (import)
    Other genes that carryout this rxn:TM1197 TM1198 TM1199 TM1196
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + lcts[e] --> adp[c] + h[c] + lcts[c] + pi[c]

     

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch